>4rof_D mol:protein length:14  Thioredoxin-interacting protein
XTPEAPPCYMDVIX
>4rof_B mol:protein length:47  E3 ubiquitin-protein ligase Itchy homolog
GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ
>4rof_D mol:protein length:14  Thioredoxin-interacting protein
XTPEAPPCYMDVIX
>4rof_C mol:protein length:14  Thioredoxin-interacting protein
XTPEAPPCYMDVIX
>4rof_A mol:protein length:47  E3 ubiquitin-protein ligase Itchy homolog
GRRASVELPLGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQ