>4rtp_F mol:na length:11  DNA (5'-D(*TP*TP*TP*AP*AP*AP*GP*AP*TP*CP*G)-3')
TTTAAAGATCG
>4rtp_A mol:protein length:298  DNA adenine methylase
MGSSHHHHHHSSGLVPRGSHMKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAG
SVFLNTDFSRYILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEF
NKSQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQN
AFFYCESYADSMARADDSSVVYCDPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGL
VERHIPVLISNHDTMLTREWYQRAKLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSP
AKK
>4rtp_G mol:na length:11  DNA (5'-D(*AP*CP*GP*AP*TP*CP*TP*TP*TP*AP*A)-3')
ACGATCTTTAA
>4rtp_G mol:na length:11  DNA (5'-D(*AP*CP*GP*AP*TP*CP*TP*TP*TP*AP*A)-3')
ACGATCTTTAA