>4tmu_B mol:na length:34  DNA (29-MER)
CGGTAGAATTGTAAAATTCTACCGGTGCCTTACT
>4tmu_A mol:protein length:541  RecQ
MGSSHHHHHHSSGLVPRGSHMAQAEVYSQETLAKQVLQETFGYQQFRPGQATIIDAVLE
GRDCLVVMPTGGGKSLCYQIPALVKTGLTIVVSPLISLMKDQVDQLLANGVAAACLNST
QSREEQQAVLAGCRTGQVRLLYIAPERLMMDNFIDTLGYWDLAMVAVDEAHCISQWGHD
FRPEYAALGQLRARFPAVPFMALTATADDTTRRDIVRLLGLDDPLIEISSFDRPNIRYM
LMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAKVEDTAARLQSRGISAAAYHAGLEHEVR
ASVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPA
EAMLFYDPADMAWLRRCLEEKAPGPLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGR
QAPCGNCDICLDPPRRYDGLVDAQKALSAIARVEQRFGMGYVVEVLRGANNQRIRELGH
DKLKVYGIGRDQSQEHWVSVIRQLIHLGVVTQNIAQHSALQLTEAARPFLRGEAPLMLA
VPRVAALKPR
>4tmu_B mol:na length:34  DNA (29-MER)
CGGTAGAATTGTAAAATTCTACCGGTGCCTTACT