>4txq_B mol:protein length:163  Vacuolar protein sorting-associated protein VTA1 homolog
SMAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRK
FLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKS
FYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP