>4tzm_B mol:protein length:253  Protein HTP-2
MAPLENNYNESLNKSKDAIDDKTWSKLFPSIVSDPDRSSNFMIRAIYVVFSAVLRQRNI
LEKEYFSKNYITENLSCMTLSFKNLRAHQIAQLLRAAGDATKDGFLKEISLVVTEHDGD
VEAIEVFSMKFIYFENGGVVARLSTDNNDQEDPHFAELAQLRYEGAESVRDQMVTIVRS
VQFLCTKVLEPLPAEFTANFRLKYTNDAPSNFRIDGFDDSSTFYTLPDGIQSVTIGHLR
PGHHAAHMQCWSKSMSD