>4u6r_A mol:protein length:455  Serine/threonine-protein kinase/endoribonuclease IRE1
MGHNHRHKHHHHHHHHENLYFQGPGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGA
EGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYI
AIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMP
NAHGKIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIF
SAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDP
QKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRE
NITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGTLPDDFVCYFTS
RFPHLLAHTYRAMELCSHERLFQPYYFHEPPEPQPPVTPDAL
>4u6r_A mol:protein length:455  Serine/threonine-protein kinase/endoribonuclease IRE1
MGHNHRHKHHHHHHHHENLYFQGPGSSPSLEQDDGDEETSVVIVGKISFCPKDVLGHGA
EGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYI
AIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMP
NAHGKIKAMISDFGLCKKLAVGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIF
SAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHEDVIARELIEKMIAMDP
QKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRE
NITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGTLPDDFVCYFTS
RFPHLLAHTYRAMELCSHERLFQPYYFHEPPEPQPPVTPDAL