>4uft_R mol:na length:6  5'-R(*CP*CP*CP*CP*CP*CP)-3'
CCCCCC
>4uft_R mol:na length:6  5'-R(*CP*CP*CP*CP*CP*CP)-3'
CCCCCC
>4uft_B mol:protein length:391  NUCLEOPROTEIN
MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLI
GNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFAS
RGTNMEDEADQYFSHDDPISSDQSRFGWFENKEISDIEVQDPEGFNMILGTILAQIWVL
VAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVAL
ILDIKRTPGNKPRIAEMICNIDTYIVEAGLASFILTIKFGIETMYPALGLHEFDGELST
LESLMNLYQQMGETAPYMVILENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGLNFGR
SYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA