>4uis_G mol:protein length:162  LYSOZYME
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVIT
KDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSL
RMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYK
>4uis_B mol:protein length:241  GAMMA-SECRETASE
XXXXXXXXXXXXHVIMLFVPVTLCMVVVVATIXXXXXXXXXXXXXXXXXXXXXXXXXXX
LLLFFFSFIYLGEVFKTYXXXXXXXXXXLIWNFGXXXXXXXXXXXXXRLQQAYLIMISA
LMXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXX
XXXWNTTIACFVAILIGLCLTLLXXXXXXXXXXXXXXXXXGLVFYFATDYLVQPFADQL
AFHXX
>4uis_A mol:protein length:588  GAMMA-SECRETASE
IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLES
KHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYHCREIQWNSLG
NGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVIST
ATCMRRSSIAAVCDPLSDYNVWSMLKPIADDVVVAATRLDSRSFAWNVAPGAESAVASF
VTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDS
FVELGQVALRTSLELWMHTDPVQKNESVRNQVEDLGAGVPAVILRSGVPLPPSSLQRFL
RARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLAPEEDLNFVTDTAKALADV
ATVLGRALYELAGGDTVQADPQTVTRLLYGFLIKLRQDLRSYLGDGPLQHYIAVSSPTN
TTYVVQYALANLTGTVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTARL
ARALSPAQWSSTEYSTWTESRWKAIRARIFLIASXXXXXXXXXXXXXXXXXXXXXXX
>4uis_D mol:protein length:62  GAMMA-SECRETASE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXX
>4uis_D mol:protein length:62  GAMMA-SECRETASE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXX
>4uis_C mol:protein length:196  GAMMA-SECRETASE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXX