>4uis_A mol:protein length:588  GAMMA-SECRETASE
IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLES
KHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQCPNDGFGVYHCREIQWNSLG
NGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVIST
ATCMRRSSIAAVCDPLSDYNVWSMLKPIADDVVVAATRLDSRSFAWNVAPGAESAVASF
VTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDS
FVELGQVALRTSLELWMHTDPVQKNESVRNQVEDLGAGVPAVILRSGVPLPPSSLQRFL
RARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLAPEEDLNFVTDTAKALADV
ATVLGRALYELAGGDTVQADPQTVTRLLYGFLIKLRQDLRSYLGDGPLQHYIAVSSPTN
TTYVVQYALANLTGTVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTARL
ARALSPAQWSSTEYSTWTESRWKAIRARIFLIASXXXXXXXXXXXXXXXXXXXXXXX