>4uy1_B mol:protein length:131  GROUP 10 SECRETORY PHOSPHOLIPASE A2
GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCS
PKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPD
SPKCDQGILELAG