>4v1m_H mol:protein length:146  DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTI
ASSLNLEDTPANDSSATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSF
GGLLMRLEGNYRNLNNLKQENAYLLIRR