>4v42_AJ mol:protein length:156  30S RIBOSOMAL PROTEIN S7
MARRRRAEVRQLQPDLVYGDVLVTAFINKIMRDGKKNLAARIFYDACKIIQEKTGQEPL
KVFKQAVENVKPRMEVRSRRVGGANYQVPMEVSPRRQQSLALRWLVQAANQRPERRAAV
RIAHELMDAAEGKGGAVKKKEDVERMAEANRAYAHYRW