>4v42_AK mol:protein length:138  30S RIBOSOMAL PROTEIN S8
MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYL
RVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGV
LTDREARKLGVGGELICEVW