>4v42_AL mol:protein length:128  30S RIBOSOMAL PROTEIN S9
MEQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRF
DAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHK
ARRAPQYSKR