>4v42_AP mol:protein length:126  30S RIBOSOMAL PROTEIN S13
MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREY
VENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
GKKKAPRK