>4v42_AQ mol:protein length:61  30S RIBOSOMAL PROTEIN S14
MARKALIEKAKRTPKFKVRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKA
SW