>4v42_AV mol:protein length:93  30S RIBOSOMAL PROTEIN S19
MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVP
VYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK