>4v42_BJ mol:protein length:128  50S RIBOSOMAL PROTEIN L7/L12
MTIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEF
DVVLKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAVIKSGVSKEEAEEIKKKL
EEAGAEVELK