>4v42_BO mol:protein length:164  50S RIBOSOMAL PROTEIN L15
TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQE
EAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHEL
TLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE