>4v42_BR mol:protein length:66  50S RIBOSOMAL PROTEIN L19
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEA
GEAEDEA