>4v42_BW mol:protein length:70  50S RIBOSOMAL PROTEIN L29
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTI
QGEEGDLQENE