>4v42_BX mol:protein length:60  50S RIBOSOMAL PROTEIN L30
MPRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVAHLVRVEVV
E