>4v4b_AB mol:protein length:185  40S ribosomal protein S0-A
AQLLLAANTHLGARNVQVHQEPYVFNARPDGVHVINVGKTWEKLVLAARIIAAIPNPED
VVAISSRTFGQRAVLKFAAHTGATPIAGRFTPGSFTNYITRSFKEPRLVIVTDPRSDAQ
AIKEASYVNIPVIALTDLDSPSEFVDVAIPCNNRGKHSIGLIWYLLAREVLRLRGALVD
RTQPWSIM