>4v4b_AI mol:protein length:142  40S ribosomal protein S16
SAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKF
SNIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIA
DSRRPEPKKFGGKGARSRFQKSYR