>4v4b_AJ mol:protein length:100  40S ribosomal protein S20
KIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTW
ETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVVASN