>4v4b_BA mol:protein length:217  60S ribosomal protein L1
MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCP
RPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIK
QVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEED
VLVNQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY