>4v4b_BR mol:protein length:137  60S ribosomal protein L23
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVM
ATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPV
GKECADLWPRVASNSGVVV