>4v4b_BY mol:protein length:87  60S ribosomal protein L37-A
GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTG
TGRMRYLKHVSRRFKNGFQTGSASKASA