>4v5k_AK mol:protein length:129  30S RIBOSOMAL PROTEIN S11
MAKKPSKKKVKRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPY
AAQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVDDTPVPHNG
CRPKKKFRKAS