>4v5k_AQ mol:protein length:105  30S RIBOSOMAL PROTEIN S17
MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEI
IESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA