>4v5k_AY mol:protein length:97  COLICIN-E3
KGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQA
GELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL