>4v5k_B0 mol:protein length:85  50S RIBOSOMAL PROTEIN L27
MAHKKGLGSTRNGRDSQAKRLGVKRYEGQVVRAGNILVRQRGTRFKPGKNVGMGRDFTL
FALVDGVVEFQDRGRLGRYVHVRPLA