>4v5k_B6 mol:protein length:54  50S RIBOSOMAL PROTEIN L33
MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI