>4v5k_BE mol:protein length:206  50S RIBOSOMAL PROTEIN L3
MKGILGVKVGMTRIFRDDRAVPVTVILAGPCPVVQRRTPEKDGYTAVQLGFLPQNPKRV
NRPLKGHFAKAGVEPVRILREIRDFNPEGDTVTVEIFKPGERVDVTGTSKGRGFAGVMK
RWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGKKMAGHYGAERVTVMNLEVVDVIP
EENLLLVKGAVPGPNGGLVIVRETKKAAK