>4v5k_CO mol:protein length:89  30S RIBOSOMAL PROTEIN S15
MPITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMM
VGQRRRLLRYLQREDPERYRALIEKLGIRG