>4v5k_DP mol:protein length:150  50S RIBOSOMAL PROTEIN L15
MKLSDLRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGRSTTL
MRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGLLKKGYRLKILGEG
EAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA