>4v7h_BI mol:protein length:165  60S ribosomal protein L10
RPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVHLVSNELEQLSS
EALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINKMLSCAGADRLQQGMRGAWGK
PHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQKIILS