>4v7h_BN mol:protein length:150  60S ribosomal protein L17(A)
YGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRR
FNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQ
APKQRRRTYRAHGRINKYESSPSHIELVVTEK