>4w2f_AE mol:protein length:162  30S Ribosomal Protein S5
MPETDFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAG
YYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDI
LTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQG