>4w2f_AL mol:protein length:132  30S Ribosomal Protein S12
MPTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTS
GYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYG
TKKPKEAAKTAAKK