>4w2f_B7 mol:protein length:49  50S Ribosomal Protein L34
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRKR