>4w2f_CD mol:protein length:209  30S Ribosomal Protein S4
MGRYIGPVCRLCRREGVKLYLKGERCYSPKCAMERRPYPPGQHGQKRARRPSDYAVRLR
EKQKLRRIYGISERQFRNLFEEASKKKGVTGSVFLGLLESRLDNVVYRLGFAVSRRQAR
QLVRHGHITVNGRRVDLPSYRVRPGDEIAVAEKSRNLELIRQNLEAMKGRKVGPWLSLD
VEGMKGKFLRLPDREDLALPVNEQLVIEFYSR