>4w2f_CJ mol:protein length:105  30S Ribosomal Protein S10
MPKIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDS
REHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKTVGGGR