>4w2f_CM mol:protein length:126  30S Ribosomal Protein S13
MARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREY
VENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVA
GKKKAPRK