>4w2f_CR mol:protein length:88  30S Ribosomal Protein S18
MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLS
AKEQRILAKTIKRARILGLLPFTEKLVRK