>4w2f_CS mol:protein length:93  30S Ribosomal Protein S19
MPRSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQHVP
VYITENMVGHKLGEFAPTRTYRGHGKEAKATKKK