>4w2f_D5 mol:protein length:60  50S Ribosomal Protein L32
MAKHPVPKKKTSKARRDARRSHHALTPPTLVPCPECKAMKPPHTVCPECGYYAGRKVLE
V