>4w2f_D6 mol:protein length:54  50S Ribosomal Protein L33
MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI