>4w2f_DQ mol:protein length:141  50S Ribosomal Protein L16
MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFR
RGGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEAL
RIAGHKLPIKTKIVRRDAYDEAQ