>4wf9_O mol:protein length:102  50S ribosomal protein L21
MFAIIETGGKQIKVEEGQEIFVEKLDVNEGDTFTFDKVLFVGGDSVKVGAPTVEGATVT
ATVNKQGRGKKITVFTYKRRKNSKRKKGHRQPYTKLTIDKINA